SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479214810|ref|YP_007842192.1| from Eubacterium rectale M104/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479214810|ref|YP_007842192.1|
Domain Number 1 Region: 59-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 5.23e-24
Family Ribosomal protein L9 C-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.84e-17
Family Ribosomal protein L9 N-domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479214810|ref|YP_007842192.1|
Sequence length 148
Comment LSU ribosomal protein L9P [Eubacterium rectale M104/1]
Sequence
MKVILLQDVKPLGKKGEIVNVSDGYARNNIIPKKLGVEATPKNLNDLKLQNQHADKVAQE
NYESALALAKVVENTKVVVKLRSGEGGRTFGSISTKEISAAAKEQHGLELDKKKMQLNES
IKALGNYEVPVKLHPKVTANLTVSVVEG
Download sequence
Identical sequences A0A173SW19 A0A174IZF5 C4ZDL0 D4JID5
gi|238925603|ref|YP_002939120.1| 2004044579 WP_012744013.1.101161 WP_012744013.1.21182 WP_012744013.1.25308 WP_012744013.1.32465 515619.EUBREC_3259 gi|479214810|ref|YP_007842192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]