SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479216034|ref|YP_007843416.1| from Eubacterium rectale M104/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479216034|ref|YP_007843416.1|
Domain Number 1 Region: 164-349
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-55
Family Methylesterase CheB, C-terminal domain 0.00000861
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily CheY-like 1.99e-28
Family CheY-related 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479216034|ref|YP_007843416.1|
Sequence length 353
Comment Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Eubacterium rectale M104/1]
Sequence
MKSNILIVDDSALLRRVECDIINSDNKLQATDTCKDGLEALEKLRTQKYDAVILDINMPR
MNGLEVLSHLQKESIKTPVVVVSTLTIEGADEAIKSLELGAFDFVTKPNNIIEAKGNQFK
ETLLRVVYAAVRITPAHSASRNLTVVEKKAGAIVNKHKAAGSNKIVAIASSTGGPKALQS
VIPFLPAELLAPVVLVQHMPAGFTKSMAERLNELSQVQVKEASNGEVLKNGVVYIAPGGT
HIAIKKSGASHVISFNDMPPISGLKPCANIMFDSLTSSNYDEVVCVVLTGMGADGTNGIL
SLGKSKPIYVIAQDEKSSVVYGMPRAIYEAGVVDEVVTLSDVAKAITKNVGVK
Download sequence
Identical sequences A0A173W708 A0A1Q6PDR5 C4ZA87 D4JND7 D6E4X6 R6U3M9
515619.EUBREC_1784 gi|479216034|ref|YP_007843416.1| WP_012742626.1.101161 WP_012742626.1.32465 gi|238924146|ref|YP_002937662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]