SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479216223|ref|YP_007843605.1| from Eubacterium rectale M104/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479216223|ref|YP_007843605.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.35e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479216223|ref|YP_007843605.1|
Sequence length 105
Comment Phosphotransferase system cellobiose-specific component IIA [Eubacterium rectale M104/1]
Sequence
MNEKFELSCFQIITYVGTARTHFINAIHCAKEGKYDEAAELIKQGDEAFSLGHNVHADLL
AMDANGEISNGYMLLMHAEDQLMSAEAFRILADEFITLYKRIDEK
Download sequence
Identical sequences A0A0M6WTP6 A0A173W231 C4ZEF1 D4JNX6 D6DZZ1
gi|479216223|ref|YP_007843605.1| 515619.EUBREC_3688 WP_012744397.1.101161 WP_012744397.1.21182 WP_012744397.1.25308 WP_012744397.1.32465 WP_012744397.1.4596 gi|238926030|ref|YP_002939548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]