SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384058656|ref|YP_005497784.1| from Acetobacter pasteurianus IFO 3283-26

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384058656|ref|YP_005497784.1|
Domain Number 1 Region: 39-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.82e-79
Family Phosphate binding protein-like 0.00000000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384058656|ref|YP_005497784.1|
Sequence length 344
Comment thiosulfate-binding protein [Acetobacter pasteurianus IFO 3283-26]
Sequence
MKNKDFSLSRRRLLVGAAALGGGAFLGVHAGEAQAASFNLLNVSYDPTRELYADVDKAFA
NVWHQAHPEDSVTVKTAHGGSGAQARSVLEGVPADVVTLGLAYDIDLLVQKGLIAPDWQT
RLPHNSTPYTSTIVFLVRKGNPKNIKDWPDLVRDGVQVITPNPKTSGGARWNYLAAWGWA
LHQNNGSEDAAKTYLKSLFKHVPVLDTGARGATNSFVQRHLGDVLLAWEDEALMAARDIG
PGQFDIVVPSHTILAEPPVSLVDKNVKAHGTEAVAKAYLEFLFSPEGQKIGAKHYFRPVD
PAVLAEYGQVFPKVETFDVASLGGWTKLQKDHFSNGGIFDSLYR
Download sequence
Identical sequences C7JB14 S6DB29
gi|384052783|ref|YP_005485877.1| WP_003623703.1.36695 WP_003623703.1.37930 WP_003623703.1.38618 WP_003623703.1.45580 WP_003623703.1.55019 WP_003623703.1.62313 WP_003623703.1.64431 WP_003623703.1.65311 WP_003623703.1.71918 WP_003623703.1.88241 WP_003623703.1.96488 WP_003623703.1.99323 gi|384061950|ref|YP_005482592.1| 634452.APA01_01350 gi|529231600|ref|YP_008392415.1| gi|384118026|ref|YP_005500650.1| gi|384058656|ref|YP_005497784.1| gi|258541237|ref|YP_003186670.1| gi|384049673|ref|YP_005476736.1| gi|384041158|ref|YP_005479902.1| gi|384056015|ref|YP_005488682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]