SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s13009451g002 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s13009451g002
Domain Number 1 Region: 386-503
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.84e-20
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PDK_20s13009451g002
Sequence length 555
Comment [locus_tag="PDK_20s13009451L002"] [product="sulfate transporter"] [strand="+"]
Sequence
MSYAKLAGLHPIYGLYSGFVPIFAYAIFGSSRQLAIGPVTMVSLLVSNAVSAIVDYPSDE
LYTELAILLAFMVGVVECIMGLLRLGWLLRFISRSVISGFITASAIVIALSQTKYLLGYN
IDRSSEIVPLAKSIIAGAEKFSWPPFVMGSTILSVIILMKHLGKTKKNLRFLRSSGPLLA
VILGTSFMKIFQPSSISVVGEIPQGLPKFHIPREFQYARSLISTAFLITSVAVLESVGIA
KALAAKNGYQLDPNQELFGLGMANICGSFFSAYPSTGAFSRSAVNHDSGAKTGLSGVTMG
LTVGCALFFLTPLFTDIPQCALAAIVISVGISLVDYEEAMFLWHVDKKDFLLWTITCITT
LFLGIEIAVLGRLPGTTVYRNIEQYPEAYIHDGIVVVQIDAPIYFANVSYIRDRLQEYQT
TKYGPEAERVYFVIIEMASVPYIDCSAVQALKDLHQEYKSQEIQIVISNPNRKVLLTLSR
SGLVEMIGKNWYFVSVHEAVEACLQEMPNLHGTISRLVGNSTACGQPNFLQKLWKQQSGD
DSPLGQEPLLPENVI
Download sequence
Identical sequences PDK_20s13009451g002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]