SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s13009463g004 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s13009463g004
Domain Number 1 Region: 7-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.49e-67
Family G proteins 0.00000454
Further Details:      
 
Domain Number 2 Region: 185-212,242-335
Classification Level Classification E-value
Superfamily Translation proteins 1.48e-25
Family Elongation factors 0.00048
Further Details:      
 
Domain Number 3 Region: 915-1018
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-21
Family B3 DNA binding domain 0.0012
Further Details:      
 
Domain Number 4 Region: 385-460
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.08e-17
Family Translational machinery components 0.00051
Further Details:      
 
Domain Number 5 Region: 327-387
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.83e-16
Family EF-G/eEF-2 domains III and V 0.00022
Further Details:      
 
Domain Number 6 Region: 568-629
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000043
Family Translational machinery components 0.0023
Further Details:      
 
Weak hits

Sequence:  PDK_20s13009463g004
Domain Number - Region: 630-656
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00412
Family EF-G/eEF-2 domains III and V 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PDK_20s13009463g004
Sequence length 1098
Comment [locus_tag="PDK_20s13009463L004"] [product="translation elongation factor"] [strand="-"]
Sequence
MWVMQRVTFNISYHIINIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDR
QMRRYEVPRLAFINKLDRMGADPWKVLNQARSKLRHHSAAVQVPIGLEEEFQGLVDLVEL
KAYYFHGASGEKVVTEDIPPKLEALVTEKKRELIEVVSEVDDKLAEAFLNDEPISSSDLK
MAIRRATIARKFVPVFMGSAFKNKGVQPLLDGVLNYLPYPTEVENYALDQNNSEEKVLLP
GTPVGPFVALAFKLEEGRFGQLTYLRIYEGVIRKGDFMINVNTGKKIKVPRLVRMHADEM
EDIQEAHAGQIAAVFGVDCASGDTFTDGSFSKALNRFQREDPTFRVGLDVESGQTIISGM
GELHLDIYVERIRREYKVEAKVGKPRVNFRETVTQRAAFDYLHKKQSGGQGQYGRVCGYI
EPLPMDSPTKFEFENLLIGQAIPSNFIPAIEKGFKEASNSSVAVVCLSFKGAALKPGWME
AEANKSLRWNWKVVMESADFLMSIACWIHFAVGRNRSLWYLPCSFAGFAEYDGKYPGREW
GEITNGLLIVAHEVSKKLEDPSEFNVHTQSIAWAGIQCAVLRGSLIGHPVEYVRVVLTDG
ASHAVDSSELAFKLAAIYAFRQCYAAAKPVILEPVMKVELKAPTEFQGTVTGDINNCEFA
GWYKELNIFTYESQEESLTEPFWIMGDSLLVLIICKESSAASLDLGCVGPWVSGFVVLRY
MILWSALVLLLRLLALRLRGDSDSVIGFLVYWTISISDFCSWVSREVMQTFLPQHNQRLF
ALSARTVKDEKVNNVDQTIAGSASGLPTISADGRMDVSAVGKGKVVMRLGKNIDSNQQRI
VDIEQRKSVNGSFRHIRWNHLAPNAGEVGRLTLGTSSAERPLVMLPPPNALTEGGDQNIA
SSAFQQIQSSNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLTVQDA
KGKEWHFQFRFWPNNNSRMYVLEGVTPCIQSLQLQAGDTVTFSRIDPEGKLVMGFRKATN
TAPLQEPPVLGKKTIYTARLTGHVSLFSKKCDHLQQDCSGYMHDLWLSGNREFVSHVMDF
EFVLSKYGKAFLQQLVAP
Download sequence
Identical sequences PDK_20s13009463g004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]