SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s1320631g004 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s1320631g004
Domain Number 1 Region: 78-158
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000159
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PDK_20s1320631g004
Sequence length 244
Comment [locus_tag="PDK_20s1320631L004"] [product="sulfate transporter"] [strand="-"]
Sequence
VDYEEALFLWRIDKKDFLLWTITFITTLIFGIEIGVIVGVGFSLAFVIHESANPHIALLG
RLPGTTVYRNILQYPEGYTYNGIVVVRIDAPIYFANISYIKDRLREYERNLSGTANRGPD
VGRIYFVILEMSPVTYIDASAVQALKDLHQEYNSRGIQNLDGITPTAVDRTPRRQQNFLQ
SLRQHEGGGTPIQIFHPSMTLISITIVSLKSHIFVSFLIYSLDISFSFPCAITLEPYLSM
PSGS
Download sequence
Identical sequences PDK_20s1320631g004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]