SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s1325671g002 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s1325671g002
Domain Number 1 Region: 145-231
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000135
Family B3 DNA binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PDK_20s1325671g002
Sequence length 262
Comment [locus_tag="PDK_20s1325671L002"] [product="ap2 domain-containing transcription factor"] [strand="-"]
Sequence
MASLPSNQYGFPLVAVKEEVDDPGFHISSSLHHFPTRQEGTHAMMMASSSSSRARGNNAR
TLQRLGSGMPMPYSNAVWNIAQTYATGIHYINNLVSNLSRPELPVRKLGFQDPISRSHRL
SIGGHSAIPTGPRSDGDGRGNSEGFGLKLTYSGMQYLNRLIIPAQPAKRFFPDAPYLMFW
DEQSRRWWIFQYCRSSCGQRYAFVSGWSSFAKEKALKPDDTLIFKAFTDNEILENCYYTI
DVRRAARKKEQIKLFGAVIEID
Download sequence
Identical sequences PDK_20s1325671g002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]