SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s1356113g004 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s1356113g004
Domain Number 1 Region: 113-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-19
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PDK_20s1356113g004
Sequence length 302
Comment [locus_tag="PDK_20s1356113L004"] [product="b3 dna binding domain containing protein"] [strand="+"]
Sequence
MSTNALRANLMNYLLSYHGSLYDDLPHPFSASNLKVHNDAIKDPSNTSQMQMKSSSPNTP
NKLYPESACQCNPMAGPNVLSASTRGSLMNFVDDGHLDVKETMNHGLEELKMVLQKELTN
SDVGRIGRIVLPKKEAESNLPPLSERDGMMLQMDDLILPTTWKFKYRFWPNNRSRMYIME
TTGDFVRTHGLEAGDFFIIYKSSASGNYAVASKKGNRLPTSVDLLHCHTMNQCNMNEDGN
SCLSRIGKVRGAKHQLCLEPSKSLGQGSHSFLTVARNDSLRTGVLNDFDGHPAGPHFQNL
PP
Download sequence
Identical sequences A0A2H3YSE8
XP_008802959.1.81946 PDK_20s1356113g004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]