SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s1529311g003 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s1529311g003
Domain Number 1 Region: 106-195
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-23
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PDK_20s1529311g003
Sequence length 213
Comment [locus_tag="PDK_20s1529311L003"] [product="similar to predicted protein"] [strand="-"]
Sequence
MEASRRVTLQQWQQVKWLLFLSLTIVKGGGRRMSPPIPCGDVKIKTEDDELPICMIGSPT
RQYRGYVSRRRPVTAEERAKAREDANSFTSIFPHMIMRMTAMSVYRTYMLVSLLSSEIRL
RIPAWFSRAHLPRKRTNLVLRDPNGKAWVVVYIPCSRDRLSGGWSAFSRGNNLEEGDYCA
FELVGPVEMRVHIFRVVEETIPVIRMTRMQEMH
Download sequence
Identical sequences PDK_20s1529311g003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]