SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s1869091g001 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s1869091g001
Domain Number 1 Region: 64-200
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-40
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 616-685
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000834
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PDK_20s1869091g001
Sequence length 810
Comment [locus_tag="PDK_20s1869091L001"] [product="arf1-binding protein"] [strand="-"]
Sequence
TEDGERIFYFPQGHIEQVVASTNQLADKQAEQETDEVFAQVTLLPEANQDENALEKENLP
SPPPRPHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMRLQPPTQELVAKDLHGVE
WRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGEYGELRVGVRRAMRQQANVP
SSVISSHSMHLGVLATAWHAVTTGTMFTVYYKPRFTGTIVGIGDVDSSSWPGSKWRCLKV
RWDETSFVPRPERVSPWNIEPALAPPLNPLPTPRTKRPRPNAMPSSPDSSVLTKEGANKV
TADPSQVHGVPRVLQGQENMTLRSNLSDSNDSDTVQKPLMWPSSLDEDKNDGSYQRRLGS
DNWMQINRHEPTYKDMLSGFRPFGDMRGCGKHFIEQMSTGTNRLKNYFQDQEGNVNLLLD
QYSLMPSNPTFNMESTLRMPTHSGDLPYQKAQNVTYGGLEDYCLVQGRRVEQNLPNWPAH
LQSTSQSENFARQRVVKPQPSVAAQNEITRPKESGNCKLFGFHLNSTSAPSDHVMRSEHS
MPQPNATNDSVSHTQPTVAQNQSQALEGDRHSKLPSGTKLVTTAPAATEHEMYHQHCPQT
AKEVQSKLQGGSSRSCTKVHKQGIALGRSVDLAKFNCYDELIAELDQMFEFEGELMAPNK
NWLIVYTDDEGDMMLVGDDPWLFLKQRSGKEKDSWKAFSLVGSSRITLCHEICTGKWLNR
RLCEPNRLDINSTGFMRLCNVVDLGYSLNAGGDISENMVGPRDKMVCSIHFAEKPEQTNN
ANFPGPPVVDPRHWCSYSGITESLLDMTNV
Download sequence
Identical sequences PDK_20s1869091g001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]