SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PDK_20s1971021g001 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s1971021g001
Domain Number 1 Region: 105-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-27
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 524-556
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000126
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PDK_20s1971021g001
Sequence length 696
Comment [locus_tag="PDK_20s1971021L001"] [product="arf1-binding protein"] [strand="-"]
Sequence
SEDALYTELWLACAGPLVTVPRAGERVFYFPQGHIEQDFTVFPLVLVRLVYLIEKVFYFP
QGHMEQVEASTNQVADQQMPIYNLPSKILCRVINVQLKILVPMAVLRRHADECLPPLDMC
RQPPSQELAAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENG
ELRVGVRRALRQQTNIPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPSEFIVP
YNQYMESLKSNHSIGMRFKMRFEGEETPEQRFTGTIVGIGDADPNRWPGSKWRCLKVRWD
ETSSVPRPERVSPWKIEPALSPPMNPPPVPRPKRPRSNVMPCSPDSSILTKEAASKVNVD
PSHSHGTTRVLQGQELMTLRSSFADDKESENAQKPIMWSSSHDEEKTDASVQRRLGSEKR
WMQMVRPEPTYADLLSGYRPHDSHGFSSTLFEQNPGEAYLLKNHFQDTEGRHNMLPGQWS
LMPPNSSFASHELNFKITAQPGEHSYQKAGSMRCAGKGELMAPNKNWLVVYTDNEGDMML
VGDDPWHEFCSMVRKIFIYTREEVQRMNPGTLSSRVEESPASSEERAAAKGRKGLVFLME
ERPWLGPTFDRRGQAGGYWSIGCEWAKNYGDGWRFNEERFDKRDRTDLYSTVHHRSSVIK
VFVMVIVRTDGFSCLNFADQRFMVSGASDEILNLFL
Download sequence
Identical sequences PDK_20s1971021g001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]