SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000194 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000194
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-117
Family Capz alpha-1 subunit 0.000000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000194   Gene: ENSLAFG00000000238   Transcript: ENSLAFT00000000238
Sequence length 286
Comment pep:novel supercontig:loxAfr3:scaffold_11:58277480:58301229:1 gene:ENSLAFG00000000238 transcript:ENSLAFT00000000238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEDIDGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEVQTAKEFIKIIEHAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences G3TTR3
XP_010587881.1.64505 ENSLAFP00000018971 ENSLAFP00000000194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]