SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004867 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004867
Domain Number 1 Region: 1-351
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.7e-75
Family ADP-ribosylglycohydrolase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004867   Gene: ENSLAFG00000005807   Transcript: ENSLAFT00000005806
Sequence length 354
Comment pep:novel supercontig:loxAfr3:scaffold_27:13509538:13534791:1 gene:ENSLAFG00000005807 transcript:ENSLAFT00000005806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFKAAMLLGCVGDALGYRNASKENSALGAKIQEELKQIGGLGQLMLSPEKWPVSDNTI
MHIATAEALTTDYWCLDDLYREMVKRYVEIVEKLPGHRPDPATIEGCSQLKPDNYLLAWH
TPFNEKGSGFGAATKAMCIGMRYWKADRLETLIEVSIECGRMTHNHPTGFLGSLCTALFV
SYAIQGKPLVQWGREMMKVVPLAEEYCKKTIRHMAEYQEHWFYFEAKWQFYLEERKIAEE
KENKATFPDHYDAEERDKTYRKWSSEGRGGRRGHDAPMIAYDALLGAGDNWTELCNRAMF
HGGESGATGTIAGCLFGLLYGLNDIPKGLYQDLEHKEKLENLGEALYRLSTEEK
Download sequence
Identical sequences G3SWX8
ENSLAFP00000004867 ENSLAFP00000004867 XP_003413677.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]