SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004918 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004918
Domain Number 1 Region: 870-1080
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-54
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1069-1189
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-25
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 1243-1431
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-23
Family Pleckstrin-homology domain (PH domain) 0.00000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004918   Gene: ENSLAFG00000005863   Transcript: ENSLAFT00000005865
Sequence length 1435
Comment pep:novel supercontig:loxAfr3:scaffold_2:89591372:89721931:-1 gene:ENSLAFG00000005863 transcript:ENSLAFT00000005865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSFLEIKKPPVAPKPKFVMANNKPAPPPVAPKPDIVISSAPQSIKKTKPAIAPKPKVLK
DSPVRDISLSPSRTMNLEEHKQKVPENADDFNSKNVGNQSSDYILPACPCSSECSHKLGN
RGNSCVKQLVLEPLEMHENLENCKIDEFSLTVKTRDKCDSHGKKVKSQSGVVLKASILEE
NLKDVLTQGTSPFSSPPKHRSKDNPDVNGGCNSNKQFSIEFTDLSPSSSSFEKVSDHHHL
LQPPSDEFQIVETCQDSIRKSSSCFHSSKQLALENGKRNNFISSDEVSKKMEVKDVGPLE
IHLVPYTKKFPTPKPRKTRTACLIRQRYVDTPSESTEEPENSDSSSSCLIEDNLRNNKIS
VLPQNVLCNQQQVDKVKRGSKNELNLDSDYDREDLANSQKAVCPETFSFEKMASPLDTDS
SLSSDSKTVDGCNMSLAMDNGISITGCSALSVSLPKQLKLTSNEHLPAAYNPGVCAYQMQ
KESTIKDESSLRIIPKKPQRHSLPAAGVLKKAASEELVEKSSYPSNEEKNSEKSLERNHV
QHLCAQNHGMSSSFDVPKRASEKPVWKLPHPILPFSGNPESLKSVRMSSNSEPLGALTKP
RARSLSAVDVERSTKPCKDSQKKNSLKKLLNAKLSTCFMKGDFQKFWSKSSQLEDTTTGN
LCGGEQKGIESDWHGLLAGEEKRSKPIKAYSADNYSLESQKKRKKSRGQTSMASSPRAES
LDDQMLSRESSSQAPCRSVTSACAPEYENIHHYKETPAYENLPFIMVIGKTPEFECRNSS
NMEDTDANVYEVEDPYEAPASQLQLGSRLQHCRNSSGASQEGHNDLDLGLDDLPSDEEEV
INSSDEDDVSSGSSKGEPDPLEDKQGEDTGMKCKVHHIAKEIMSSEKVFVDVLKLLHIDF
RDAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKEMEERMLNWTEQQRIADIFV
KKGPYLKMYSTYIKEFDKNIALLDEQCKKNPSFAAVVRDFEMSPRCANLALKHYLLKPVQ
RIPQYRLLLTDYLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSL
NGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQSGMFKLNNMLSLAG
MKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISKSIEEYAKKRITFCPSRS
LDEADSENKEEVSPLGSKAPIWIPDTRVTMCMICTSEFTLTWRRHHCRACGKIVCQACSS
NKYGLDYLKNQPARVCEHCFQELQKLDHQHSPKIGSPGNHKSPSSALSSVLHSIPSGRKQ
KKIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQ
PLLGFTVTQVKDENSESKVFQLLHKNMLFYVFKAEDAHSAQNNRWIEAFQEGTIL
Download sequence
Identical sequences G3SX18
ENSLAFP00000004918 ENSLAFP00000004918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]