SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008781 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008781
Domain Number 1 Region: 961-1179
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-41
Family DBL homology domain (DH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 1335-1536
Classification Level Classification E-value
Superfamily PH domain-like 3.87e-32
Family Pleckstrin-homology domain (PH domain) 0.0000809
Further Details:      
 
Domain Number 3 Region: 1166-1282
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-22
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008781   Gene: ENSLAFG00000010491   Transcript: ENSLAFT00000010492
Sequence length 1538
Comment pep:novel supercontig:loxAfr3:scaffold_12:32819869:32953251:1 gene:ENSLAFG00000010491 transcript:ENSLAFT00000010492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAFTKDETFCRYPCWQMHRPPDSPKPPVAPKPKTTSPLTPLASPKFPSSPRPDSLHSPNS
MIRGPKPPIAPKPKLSAPHEWRASVYVNNSLNKCSNGKLLCVDRGLYEGHQSNLECSESE
ADEDYIVAPKAPVRAEEPADGDCVENEVLVPADAPGEEEHKEEGGEECDVEGSGAGEDMA
ALAEGTVSGESDGGMAQAPENAAEEEDCEGDLGEGEQVLTQKEEEEEVEEHSAYNQEDRG
PRDGEEVFQHDIPTHIKLEDPVASGEAPGLPEAPMEVEEDSEKGCAMAEARDPDERVASS
NPSEVDAEDAREEPPEKEELASDVQEAAMAVENPNVSAETCEDATGGGGQVDDAHPDPGE
STSQEEGTVVQKMDEDPQRGEGPIEDEEDEPAEDSCQIVPFENDCADSFETSLTGSPYEF
FATESTSFCSESYPPFSESAEGLESEQGSKSELCAEEDPEAGTVCGQHDPPEGAVCEGPS
VPEVVVLPEDALGEDAMDDSLTNPYVLGVGLACQADWCEAQTGPNALSGYATREEMSSDV
DGGLLPIDRKNLVSRARPHSGKVAGYVPETVPEETGPESGSAAVGSGGAIAEARKTGLSL
EGKPPEATSRALPAKPRAFTLYPRSFSVEGREIPFSLFREPEGSGLDDHRIKRNEDNLSL
PCMIGSSGSFSQRNHLPSSGTSTPSSVVDIPPPFDLACITKKPITKSSPSLLTESDSLDK
HTKKKKSSFKRFLALTFKKKTESKVHVEVNVSSSRSSSESSYHGPSRLLEIDRRSLSNSP
QLKSRTGKLRASESPSSLIFYRDGKRRGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSI
SFPNADTSDYENIPAMNSDYENIQIPPRRPARTGTFTKLFEDHSRAVSMANENDGYVDMS
SFNAFESKQQGADQEAESAYTEPYKVCPILAIPPTSLLTSDEEQGSSEEEESAPRDPSVT
HKVEGQSRAHVIAQELLSSEKAYVEMLQHLHLDFHGAVMRTLDEMDQEGRDVLSREELRL
GLSQLPAIHDLHQGILEELEERLAHWEGQQKVADVFLAREQGFDHHAAHILQFDRYLGLL
SENCLYSPRLAAAVREFEQSLQGGGQSVKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEY
ENTQGALTLISKVTDRVNDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVT
GKNRRPRHLFLMSDVLLYTYPQKDGKYRLKNTLAVASMKVSRPVLEKVPYALRIETSESC
LTLSASSCAERDEWYSCLNRALPEDYKAQALAAFHHSVEMRERLGVSLGERPPTLVPVTH
VMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCYGKLKKRG
GDIPGLMRERPVSMSFPLPSPRFSSSAFSSVFHSINPSTFKKQKKVPSALAEVAASGEGS
AISGYLSRYKKGKRHWKKLWFVIKGKVLYTYMASEDKVAMESMPLLGFTIAPEKEEGSSE
VGPIFHLYHKKTLFYSFKAEDTHSAQRWIEAMEDASVL
Download sequence
Identical sequences G3T5Q3
ENSLAFP00000008781 ENSLAFP00000008781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]