SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010488 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010488
Domain Number 1 Region: 11-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.99e-44
Family G proteins 0.0000177
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000262
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010488   Gene: ENSLAFG00000012544   Transcript: ENSLAFT00000012545
Sequence length 277
Comment pep:novel supercontig:loxAfr3:scaffold_49:340918:364518:1 gene:ENSLAFG00000012544 transcript:ENSLAFT00000012545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGTVESPYGHPAGIDYKTTTILLDG
RRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVP
KILVGNRLHLAFKRQVPTEQARGYAERLGVTFFEVSPLCNFNITESFTELARTVLLRHGM
DRLWRPSKVLSLQDLCCRAIVSCTPVHLVDKLPLPVALRRHLKSFSMANGLNARMMHGGS
YSLTAGSSHRRSLRKAKASRTPHSPPKHCARNSCKIS
Download sequence
Identical sequences G3T9L9
ENSLAFP00000010488 ENSLAFP00000010488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]