SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014223 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014223
Domain Number 1 Region: 11-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.58e-44
Family G proteins 0.0000233
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014223   Gene: ENSLAFG00000016968   Transcript: ENSLAFT00000016966
Sequence length 281
Comment pep:novel supercontig:loxAfr3:scaffold_53:15270083:15287111:-1 gene:ENSLAFG00000016968 transcript:ENSLAFT00000016966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQGSPVKSFDYLLKFLLVGDSDVGKGEILESLQDGASESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVTESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLAGGGGGGGSKGNSLKRSRCIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences G3THY8
XP_003417843.1.64505 ENSLAFP00000014223 ENSLAFP00000014223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]