SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014290 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014290
Domain Number 1 Region: 4-352
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.26e-73
Family ADP-ribosylglycohydrolase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014290   Gene: ENSLAFG00000017050   Transcript: ENSLAFT00000017048
Sequence length 362
Comment pep:novel supercontig:loxAfr3:scaffold_25:25442925:25449739:-1 gene:ENSLAFG00000017050 transcript:ENSLAFT00000017048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGKLIERYVAAMVLSAAGDTLGYYNGKWEFLRDGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALIEAGKAGDLAQQYSLLAKHYQNCMEDMDGRAPGGASVQNAMQLEPHKA
NGWRIPFNNHEGGCGAAMRAMCIGLRFPHQSQRDMLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQEWGKGLMEVLPEAKKYIVQSGYFVEENLQHWSYFQDQWEKYLKLRG
IRDGRSAPTFPKSFDVKERDQFYTSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVI
AL
Download sequence
Identical sequences G3TI39
ENSLAFP00000014290 ENSLAFP00000014290 XP_003412891.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]