SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014490 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014490
Domain Number 1 Region: 19-359
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 8.89e-68
Family ADP-ribosylglycohydrolase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014490   Gene: ENSLAFG00000017280   Transcript: ENSLAFT00000017280
Sequence length 362
Comment pep:novel supercontig:loxAfr3:scaffold_34:15194559:15200063:1 gene:ENSLAFG00000017280 transcript:ENSLAFT00000017280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVAMTAAGCGAAGAARSLSRFRGCLAGALLGDCVGAFYEAHDPVSLTSVLSHVQSLEPD
PSTPGSARTEVLYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVI
TVFKKLLSPKCHDVYEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLT
HASSLGYNGAILQALAVHLALQGELSSEHFLEQLLSRMEELESDAQSLSDARELGMEERP
YSSRLKKIAELLEQDSVTREEVVAELGNGIAAFESVPTAIYCFLRCMEPDPEIPSTFNNL
QRTLIYSISLGGDTDTIATMAGAIAGAYYGMEQVSESWQQSCEGYEETDILAQNLHRVFQ
KS
Download sequence
Identical sequences G3TIK6
ENSLAFP00000014490 ENSLAFP00000014490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]