SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016320 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016320
Domain Number 1 Region: 737-921
Classification Level Classification E-value
Superfamily Macro domain-like 2.52e-53
Family Macro domain 0.0000567
Further Details:      
 
Domain Number 2 Region: 1559-1739
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.25e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.023
Further Details:      
 
Domain Number 3 Region: 948-1127
Classification Level Classification E-value
Superfamily Macro domain-like 3.7e-39
Family Macro domain 0.00023
Further Details:      
 
Domain Number 4 Region: 1142-1330
Classification Level Classification E-value
Superfamily Macro domain-like 4.21e-36
Family Macro domain 0.0014
Further Details:      
 
Domain Number 5 Region: 1434-1541
Classification Level Classification E-value
Superfamily WWE domain 8.5e-20
Family WWE domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016320   Gene: ENSLAFG00000021607   Transcript: ENSLAFT00000021860
Sequence length 1741
Comment pep:novel supercontig:loxAfr3:scaffold_25:22152584:22196729:-1 gene:ENSLAFG00000021607 transcript:ENSLAFT00000021860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRQKVLERENHELVWPEKGTFKLTVQLPTPPDENFDVSGRETPTEESNTNEDAREPEERD
IKLSLNRRAENMEDTPEECENIPSLVAFENLKENVTDIMLTLLVENISGLSGNSDFQVEL
VRDCHVAVVTFQKHIEKKKMVRDRNLYANEMKVQEKVREMESYNICIIVQISGGLDISAL
IEFSDRKPVEGGLRVTTAILFPFEESMELKSSVKPKIVLDTIMTKKLVFNNLPLSVFPYY
PSLGTALYGKEKPLIKLPAPLEVPLALPIWKFLQKKNHLIEEINGEMGHCHCELIWPQLD
SVVTIRPAATLVNQGRQRLNSWSEEAATAFSVIISKYQDITFDVDPIVWDNIKNDLEDSR
VLIEFDTLKETVTIVGKSEDMQHMEPQTRKLIESIIQKIKREEQSLKEKVAVSPGKYSVL
WHSGLLEGLRKECPEVEISYDGGTGHVCLNGLPVDVYKVKCEIQEKVHTMVQKSVQAPPE
IFQFLQQVDCEEYSESLFLAKDILAVFALEGTAVLLTSCSPDVLQKAEEQMASALNYKCI
EVEDGDVLKDKRWKRHIGNLHKKHNSASKTVIIDELTSGPMAKVIIAGCARNVNETYDLL
FDFVEKHAKIERMIELKPSLVVEYLRTEKKPIWSKIRTKNVRVIFNPENKQKGILLTGPK
AEVLEGMNTIRQMRDSVCIRVTSIDKPGASQFFRDKGRYYIAEARRLFGCSIELQEDEEK
MEGGGPSGKQCCARVDLVPGVSLVVQQGDLTHFPVEVVVNASNESLNHIGGLAAALSKAA
GPELQSDCDQIVKKKGKIPPGSAVISKAGKLPYRHVIHAVGPMWKVNDAPRCTYLLRTVV
EESLYLAEKHKYKSIAIPAISSGIFGFPLQQCVKTIILAVKESFQNYRDGCTLKEIYLVD
TSEKTVEAFAAAVKTMFKDTVPDDAFLPSVPAAVQPRLRKGLEDSNTLMSPEGLRVRLVK
GDVQDVRTDVVVNSIPLDLALDKGPLSRAILEKAGPELQEELNKSGQGMTVNVGAVLKTS
GCNLHCQHVLHVVPLEWRNDSASAQKVMKDIIKECLKITEKMSLKSITFPAIGTGNLGFP
KTTFAELIILEVLRFSSKNQLTALEEVHFLLQPSDRGNIQAFSDEFARRANGNLISDKIP
KAEGTQAFYGAVSSPDLGVHEMNIGSVIFQVASGDITKEEADVIVNSTSNTFNLKVGVSR
AILQGAGRDVEQQCSLQAQQGKNDYIITEGGLLRCKNIIHVVGGHDVKKSMSFLLQECEK
RNYASICLPAIGTGNAKQDPDKVAKAIMDAIEDSVQKGSVHSVKRVKVVILLPQVLDVFY
ANMKNREGSQAPPQPSMMSKVASFLGFSRQTPKKQAALVLEKKMESAIFQVCGENEKNVR
GAISWIQDLIEKEQFTHTSEDKCIRNFDEKEYQELNELQKSFNIKISLDLKKPSIQVSGI
CRDVVTAVSTIEEMIKRVRAYTEQESRADCISEFIEWQYTNGNSFYPFDKMTNLQLEDAR
RAKRKTVDVKIHNRNYEVDLLSMTATGEGGYSLPIQRLVKSEVEIPTNWSDMKQQTSRLV
ELQPSHAEYDTVAREFNQTCSNFKIVKIERVQNPDLWNCYQAKKKTMDAKNSQINNEKLL
FHGTDADSVPHVNQNGFNRSYAGKNAVAYGKGTYFAVNASYSASDIYSRPDSMGKKHMYY
VRVLTGIYTVGNHSLIVPPSKNPQDPTDLYDTVTDNVQSPKLFVVFYDYQAYPEYLITFV
R
Download sequence
Identical sequences G3TMI0
ENSLAFP00000016320 ENSLAFP00000016320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]