SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008354 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008354
Domain Number 1 Region: 110-185
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000062
Family Ras-binding domain, RBD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008354   Gene: ENSMLUG00000009170   Transcript: ENSMLUT00000009166
Sequence length 241
Comment pep:putative scaffold:Myoluc2.0:GL429956:1051252:1061389:1 gene:ENSMLUG00000009170 transcript:ENSMLUT00000009166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHWQIECSQGNSRPALKQGEDHSALVFVSQRRPPVSTPLSGSDVEKEKETHNYLSKEEIQ
EKIHKYNLAVTDKLKMTLLQNPNGTYTGFIKVQMELCKPPQAPAPGNSGCMNTLHISSTN
TVGEVIEALLKKFLVTESPAKFALYKRCYREDQVYACKLSDREHPLYLRLAAGPRTDTLS
FVLREHEIGEVKWEAFSLPELQNFLRILDKEEDEQLYNLKRRYTAYRQKLEAALSEVWKP
G
Download sequence
Identical sequences G1PD33
ENSMLUP00000008354 ENSMLUP00000008354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]