SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009960 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009960
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.09e-53
Family G proteins 0.0000000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009960   Gene: ENSMLUG00000010940   Transcript: ENSMLUT00000010928
Sequence length 183
Comment pep:putative scaffold:Myoluc2.0:GL430155:412034:438434:-1 gene:ENSMLUG00000010940 transcript:ENSMLUT00000010928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDL
ESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC
NIQ
Download sequence
Identical sequences G1PH24 P10114
NP_066361.1.87134 NP_066361.1.92137 XP_004273691.1.21590 XP_004651119.1.11716 XP_004680115.1.23501 XP_006102004.1.53796 XP_008142206.1.99482 ENSP00000245304 9606.ENSP00000245304 ENSMLUP00000009960 ENSTTRP00000008046 gi|10518344|ref|NP_066361.1| ENSP00000245304 ENSTTRP00000008046 ENSP00000245304 ENSMLUP00000009960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]