SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021840 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021840
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.43e-32
Family Ubiquitin-related 0.000038
Further Details:      
 
Domain Number 2 Region: 99-153
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.83e-19
Family Ribosomal protein S27a 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021840   Gene: ENSMLUG00000026107   Transcript: ENSMLUT00000029599
Sequence length 155
Comment pep:putative scaffold:Myoluc2.0:GL429771:15113889:15114384:1 gene:ENSMLUG00000026107 transcript:ENSMLUT00000029599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLMGKTITLEVGPSDTIENVKAKIQDKEGIPPDQQRLIFADKQLEDRCTLSDYN
IQKESTVHLVLRLRSGAKKRKKSYTTPKKNKHKRKKNNLAVLKYYKVDDNGKISCFRPEC
PSDECGAGVFMASHFDRYYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences G1QDQ7
ENSMLUP00000021840 ENSMLUP00000021840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]