SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000142 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000142
Domain Number 1 Region: 187-393
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-54
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 2 Region: 2-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.81e-48
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-33
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 4 Region: 670-771,815-841
Classification Level Classification E-value
Superfamily SH2 domain 7.46e-24
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 5 Region: 586-661
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000144
Family SH3-domain 0.0000275
Further Details:      
 
Domain Number 6 Region: 782-829
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000387
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000142   Gene: ENSMLUG00000000153   Transcript: ENSMLUT00000000155
Sequence length 849
Comment pep:putative scaffold:Myoluc2.0:GL430510:97876:152727:1 gene:ENSMLUG00000000153 transcript:ENSMLUT00000000155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLQPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTQI
AQNKGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVPMPPKMTDYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPEDIEIIFINI
EDLLRVHTHFLKEMKEALATTSAPTLYQVFIKYKERFLIYGRYCSQVESASKHLDRVASA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKT
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGERDNKKWTHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDFAGTMKKSRRVSVKSQISCLLFIWLPKMEV
CQEYYGIPPPPGALGPFLRLNPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYV
HTFFLPPSDLTNHFKYAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVK
HIKIMTAEGLYRITEKKAFRGLAELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAISKP
TAGSTKYFGTAKVRYDFCARDRSELNLKEGDIVKILNKKGQQGWWRGEIYGRIGWFPSNY
VEEDYSEYC
Download sequence
Identical sequences G1NSM6
ENSMLUP00000000142 ENSMLUP00000000142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]