SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003910 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003910
Domain Number 1 Region: 32-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.36e-92
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 2214-2332
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-33
Family Pleckstrin-homology domain (PH domain) 0.0000202
Further Details:      
 
Domain Number 4 Region: 605-745
Classification Level Classification E-value
Superfamily Spectrin repeat 7.97e-30
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 1644-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 1855-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 4.6e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 1015-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 5.26e-27
Family Spectrin repeat 0.00000348
Further Details:      
 
Domain Number 8 Region: 819-953
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 9 Region: 1233-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 5.11e-25
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 10 Region: 1536-1676
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-24
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 11 Region: 429-530
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 749-853
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 533-640
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-19
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 14 Region: 2015-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1391-1486
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000615
Family Spectrin repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003910
Domain Number - Region: 1174-1258
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0331
Family Spectrin repeat 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003910   Gene: ENSMLUG00000004280   Transcript: ENSMLUT00000004293
Sequence length 2369
Comment pep:putative scaffold:Myoluc2.0:GL429852:1956:64089:-1 gene:ENSMLUG00000004280 transcript:ENSMLUT00000004293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PADMTSATEFENVANQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQK
KTFTKWVNSHLARKSCRITDLYKDLRDGQMLIKLLEVLSGEMLPKPTKGKMRIHCLENVD
KALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVPEGPEGRETRSAK
DALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEH
AFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRIGKVIDH
AIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKF
QEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIR
QEKLEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEE
RVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLASRRQRLETTLALQKLFQD
MLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAINTATLQFTE
GKGYQPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEK
EQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLDQIFQEAEGMVARKQFGHPQIEA
RIKEVSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHKLLSGEDVGQDEG
ATRALGKKHKDFLEELEESRAVMEHLERQAQGFPQEFRDSPDVTNRLQALRDLYQQVVAQ
ADLRRQKLQEALDLYTVFGETDACELWMGEKEKWLAQMEIPDTLEDLEVVQHRFDILDQE
MKTLMTQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTMVSDRREAVGSALRV
HNYCVDCEETSKWILDKTKVVESTKDLGRDLTGVIAIQRKLSGLERDVAAIQTRVGALER
ESRWLMESHPELKEDIGRRQAYVEELWQGLQQALQGQEASLGEASQLQAFLQDLDDFQGW
LSMAQKAVASEDTPESLPEAEQLLQQHAAIKDEIDGHQDSFERVKASGEKVLQGQMDPEY
LLLGQRLEGLGTGWDALRRMWESRGHFLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLET
PDSLEAAEAGIRKFEDFLVSMENNQDKVLNPVDSGNKLVAEGNLYADKIKEKVQSIEDRH
RKNNEKAQEASVLLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQ
AFMAELASHEGWLESIDAEGKQLMEEKPQFAALVSQRLEALHRLWDELQATTKEKAQQLS
AARSSDLRSKTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELG
ELFAQMPSLDEEEGGADMSIEKRFLDLLEPLGKRKKQLESSRAKLQISRDLEDETLWVEE
RLPLAQSSDYGINLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQRLVEEAEIDCGDIE
ERLGHLQSSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYVISDETPKDE
EGAIVMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLAAGHPEGEQIIRLQGQVDKQYAGLK
DMAEERKRKLENMYHLFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFA
RETGAIGQERVDNVNAIIERLIDAGHGEAATIAEWKDGLNEMWADLLELIDTRMQLLAAS
YDLHRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQ
DVATRLQMAYAGEKADAIQDKEREVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLL
SWMESIIRQIETQERPRDVSSVELLMKYHQGIRAEIETRSKNFNACLELGESLLQREHQA
SEEIREKLQQVMSRRKEMNEKWEARWERLSMLLEVCQFSRDASVAEAWLIAQEPYLASRD
FGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIPEPPVEETGQKQPPA
SIPHCSLSSGQFPKGRRMEVKVWEENVGSQASILLSSRPRAEPQQGVLPLCAPEQGEEER
QWPQDLQPPPPPGPQKEGQEEKSGGDERPATEPLKVLDTPLSEGDEPITLPAQQDHGHSV
QMEGYLGRKHDLEGPNKKASNRSWNHLYCVLRNSELTFYKDAKNLALGVPYHGEEPLALR
HAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWLQGVSTAINESQSIRVKAQS
LPLPSITGPDTSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences G1P234
ENSMLUP00000003910 ENSMLUP00000003910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]