SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004466 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004466
Domain Number 1 Region: 44-201
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.85e-29
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 214-294
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.62e-25
Family GAS2 domain 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004466   Gene: ENSMLUG00000004905   Transcript: ENSMLUT00000004901
Sequence length 677
Comment pep:putative scaffold:Myoluc2.0:GL429777:2778420:2797516:-1 gene:ENSMLUG00000004905 transcript:ENSMLUT00000004901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTMQPAIQVWFGEDLPLSPRSPLTPRHGPGLADVCQYDEWIAVRHKATLLPMQEDLSIWL
SGLLGIEVKADRLLEELDNGVLLCQLIDVLQNMVKACSSEEPENFPMRKVPCKKDAASGS
FFARDNTANFLHWCRHIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVL
VKLEKEIELEETLLNTSGPEDSISIPKSCCQHEELHEAVTHIAEDPPCSCSHRFSIEYLS
EGRYRLGDKILFIRGKMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQ
KGVSNENVPDSPARTPQPPEMNPMSAVSMIQKEKSKPGPPVGIPRSKEKLPAPSLKGGHP
GSVSVRSKTPQPPAASSHLKLKSSKGTAKTPQAPSHNAASSLASLTLGGKSTSSPALPRT
APCGSESLRKCISSPNTPKAKFTPAQKSRVVPDSTLLPNKCSGKTQLRNLKHNHISSRDN
AVYHSAAHLNSSSKCPKLPKPSPSVQSRAEMTKPSSKTITPGLGTRSQPSDGASQAGAVP
AQKLKSALNLNQPLSVSSVTPAEAQESKDKKVVSFAKKQPQKTGPGSSKSPVRTPLSVVS
LPQSSAKAHAVSKAAQTATRGPHSARGPPKGGKAPAPTRKPPSSVKEAVSGDKKPTAKKK
EDDDHYFVMTGSKKPRK
Download sequence
Identical sequences G1P3H0
ENSMLUP00000004466 ENSMLUP00000004466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]