SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006155 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006155
Domain Number 1 Region: 914-1041,1073-1278
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-77
Family p120GAP domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 1508-1606
Classification Level Classification E-value
Superfamily RGC domain-like 6.41e-34
Family RGC domain 0.0000109
Further Details:      
 
Domain Number 3 Region: 1-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.46e-33
Family Calponin-homology domain, CH-domain 0.0000522
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006155
Domain Number - Region: 717-781
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000345
Family Motor proteins 0.043
Further Details:      
 
Domain Number - Region: 626-657
Classification Level Classification E-value
Superfamily WW domain 0.000954
Family WW domain 0.0048
Further Details:      
 
Domain Number - Region: 1400-1485
Classification Level Classification E-value
Superfamily 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0647
Family 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006155   Gene: ENSMLUG00000006695   Transcript: ENSMLUT00000006741
Sequence length 1606
Comment pep:putative scaffold:Myoluc2.0:GL429767:37925807:38059591:-1 gene:ENSMLUG00000006695 transcript:ENSMLUT00000006741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFR
HTDNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDL
LGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANELSVDEAALHAAVIAINEAIEKG
IAEQTIITLRNPNAVLTLVDENLAQEYQKELWAAKKGKEENAKLKNNCISEEERDAYEEL
LTQAEIQGNINKVNTFIQVSELDRPMKLHSDGFISMSLRLWSCTVRSSCYLVQLYDQKTR
RLQTVMQDPIQSNQRHSGKVSDSQGAKSSGTRLAAVDHINAVIQEGDPKSTLLALERPEA
QLPAVYPFAAAMYQNELFNLQKQNAMNYLAHEELLIAVEMLSAVALLNQALDSKDLVSVQ
NQLRSPAIGFNNLDETYVGRYADELLSIKLDVLSQGQETLSWNEIQNCIDMVNIQIQEEN
DRVVAVGCINEAIDAGDPLKTLESLQFPSVKIRDLDPEHAQHYQDVLYHAKSQKLKDAPE
DPASKILWLDEIQHAVYEANRDKDKAKQWVTLVVDVNQCLEKEKKSDILSVLKSSIGNTN
DVIPECADSYYDALTKAKEQKSKSVSTEGPWLKLTLQEKYDYYYNVDSKESSWVTPKPCL
CKESWLMEKEIKDIVEEVTTGYIREKMWSAPEDFLLRLQHTRSGALLRKEFEARKSFLYE
QEEHVVKIQAFWRGHRQRMSYVSRRQTFADQLPSIVKIQSWFRMTRARRNYLSRLQYFRD
HNNEIVKIQSLLRASKARDDYKTLVGSENPPLPVIRKFVHLLDQSDLDFQEELEVARLRG
EVVTKIRGNQQLEKDLNLMDIKIGLLVKNRITLEDVISHRTKLNKKKGGEMQILNNTDNQ
GIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNKSTKFMDTVIFTLYNYASNQ
REEYLLLKLFKTALEEEVKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNTLRQLLAPVV
KEILDDSSLVINTNPVEVYKSWVNQLETQTGEASNLPYDVTAEQALTYPEVKSKLDASNE
SLRRVTDRVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVGNLLYYRYM
NPAIVAPDGFDIIDMTAGGQINSDQRRNLGTVAKVLQHAASNKLFEGENEHLASTNNYLS
ETYQKFRKYFKEACDVPEPEEKFNMDKYTDVVTVSKPVIYISIEEIINTHSLLLEHQDAI
APEKNDLLNELLELLGEVPTVESFLGEGAIDPNDPNKANTLNQLSKTEISLSLTSKYNLG
DGEGIDGQSLMIKTKKLIIDVIRNQPGNTLTEILETPATTQQETAHATDMESRAIKDSKA
PEEMKDGQSMVEDAQLPLEQKKRKIQRNLRTLEQMGHMSSTNKYQDILNEIAKDIRNQRI
YRKLRKAELAKLQQTLKALNEKAAFYEEQVNYYDTYIKTCLDNLKIKNSRRSIKLDGKGE
SKGMKRAKPVRYTAAKLHEKGVLLGIDDLQTNQFKNVTFDILSTEDVGIFDVKSKFLGVE
MEKVQLNIQDLLEMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK
Download sequence
Identical sequences G1P7P6
ENSMLUP00000006155 ENSMLUP00000006155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]