SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006939 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006939
Domain Number 1 Region: 207-340
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-40
Family Third domain of FERM 0.00000123
Further Details:      
 
Domain Number 2 Region: 97-206
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-37
Family Second domain of FERM 0.00000104
Further Details:      
 
Domain Number 3 Region: 10-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-26
Family First domain of FERM 0.0000119
Further Details:      
 
Domain Number 4 Region: 445-530
Classification Level Classification E-value
Superfamily Moesin tail domain 1.23e-25
Family Moesin tail domain 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006939   Gene: ENSMLUG00000007610   Transcript: ENSMLUT00000007601
Sequence length 530
Comment pep:putative scaffold:Myoluc2.0:GL429954:291162:292754:-1 gene:ENSMLUG00000007610 transcript:ENSMLUT00000007601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KETPPEPKMPKPINVRVTTMDAELEFAIQRDTTGNQLFDQVVRTIGLREVWYFGLQYVDN
KGFPTWLKLDKKVSAQKVRKENPLQFKFRAKFYPKDVCEELIQDITQKLFFLQVKEGILS
SEIYCPPETAVLLGSYAAQAKFGDYDKDLHKPGYLSSERLIPQRVMDQHKLTRDQWEDRV
QVWHAEHRGMLKDSAMLEYLKTAQDLEMYGISYFEIKNKRGTDLWLGVDALGLNIYEKDH
KLTPKIGFLWGEIRNISFNKKKFFIKFIDRKAPDFVFYAPCLRINKRIVPLCMGNQELYM
RRRKPDTIEVQQMKAQAREEKHLRQLERQQLETEKRREAVEREKEQMMPEKAEKELSDQN
QRALRLEEERKTVDQRKSQEQLAVARRRKEDEVEEWQHQAEEAQDDLVKTQEELQLVMTA
PPPVDEPVAYHVRENLQEEGAEDSGYSAELSSEDILDDRQEEKRVTEAEKNLQQQLMTLS
SELSQARDENKRTHNDIIHKENRRQGRDKYKTLRIRQGNTKQRIDAFEAM
Download sequence
Identical sequences G1P9M5
ENSMLUP00000006939 ENSMLUP00000006939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]