SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007101 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007101
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.13e-42
Family Calponin-homology domain, CH-domain 0.000000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007101   Gene: ENSMLUG00000007781   Transcript: ENSMLUT00000007776
Sequence length 201
Comment pep:putative scaffold:Myoluc2.0:GL430215:511324:512598:1 gene:ENSMLUG00000007781 transcript:ENSMLUT00000007776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPDGAKPVRVPENPPSMVFKQMEQVAQFLKAAEDYGVTKTDMFQTVDLFEG
KDLAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTEGQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences G1PA15 L5M2I4 S7MDL8
ENSMLUP00000007101 ENSMLUP00000007101 XP_005856875.1.60319 XP_006103017.1.53796 XP_006761621.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]