SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010694 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010694
Domain Number 1 Region: 85-218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-29
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010694   Gene: ENSMLUG00000011747   Transcript: ENSMLUT00000011740
Sequence length 220
Comment pep:putative scaffold:Myoluc2.0:GL429949:2489483:2579247:-1 gene:ENSMLUG00000011747 transcript:ENSMLUT00000011740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEEANGKGNMGTKKKNLNFLRSRLYMLERRKTDTVVESSVSGDHAGTLRRSQSDRTEY
NQKLQEKMSPQAGCAAETLTQEEEEEQQTRRMMARRSKIIEELVQTERDYLKDLELCIKE
VVQPLRNKQIDRLDVDSLFSNIESVHQISAKLLSLLEEATADVEPAMQVVGEVFLQIKGP
LEDIYKIYCYHHDKAHSVLEAYEKEEELKQQLSLCVQSLQ
Download sequence
Identical sequences G1PIY8
ENSMLUP00000010694 ENSMLUP00000010694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]