SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010793 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010793
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 4.71e-36
Family Ribosomal protein L20 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010793   Gene: ENSMLUG00000011857   Transcript: ENSMLUT00000011847
Sequence length 149
Comment pep:putative scaffold:Myoluc2.0:GL431704:2847:6663:1 gene:ENSMLUG00000011857 transcript:ENSMLUT00000011847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTTQLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVIRAFVKCTKARRRK
RGILRTLWINRITAASQEHGLHYPAFVGNLVKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRREEGFAAALGDGKEPEGIFSRVVQYH
Download sequence
Identical sequences G1PJ75
XP_006108374.1.53796 ENSMLUP00000010793 ENSMLUP00000010793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]