SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010866 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010866
Domain Number 1 Region: 217-357
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-44
Family Third domain of FERM 0.00000017
Further Details:      
 
Domain Number 2 Region: 107-216
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-40
Family Second domain of FERM 0.000000586
Further Details:      
 
Domain Number 3 Region: 514-601
Classification Level Classification E-value
Superfamily Moesin tail domain 3.14e-33
Family Moesin tail domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 20-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.62e-26
Family First domain of FERM 0.00000861
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010866
Domain Number - Region: 451-495
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00837
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010866   Gene: ENSMLUG00000011922   Transcript: ENSMLUT00000011927
Sequence length 601
Comment pep:putative scaffold:Myoluc2.0:GL430037:521131:571176:-1 gene:ENSMLUG00000011922 transcript:ENSMLUT00000011927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYRSEEFLKKVTKREEKCRNQIINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREV
WFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLF
FLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEVHKPGYLANDRLLPQRVLEQHK
LTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDA
LGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILA
LCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKEKIER
EKEELMERLRQIEEQTLKAQKELEEQTRKALELEQERKRAKEEAERLEKERRAAEEAKSA
IAKQAADQMKNQEQLAAELAEFTARITLLEVAKKKKEEEANEWQQKAYAAQEDLEKTKEE
LKSVMSGPPPPPPPPVIPPTENEHDEHDENNAEASAELSSDGVMNHRSEEERVTETQKNE
RVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEA
M
Download sequence
Identical sequences G1PJE2
ENSMLUP00000010866 ENSMLUP00000010866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]