SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013234 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013234
Domain Number 1 Region: 910-1191
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.62e-80
Family Complement components 0.0000311
Further Details:      
 
Domain Number 2 Region: 1272-1402
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 7.85e-32
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 746-798
Classification Level Classification E-value
Superfamily E set domains 0.0000000448
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013234   Gene: ENSMLUG00000014532   Transcript: ENSMLUT00000014546
Sequence length 1435
Comment pep:putative scaffold:Myoluc2.0:GL429826:4760986:4874804:1 gene:ENSMLUG00000014532 transcript:ENSMLUT00000014546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPQLLTAAHLVCVWTVWTAALAAAPGPRFLVTAPGTVRPGGNVTIGVHLLEHSPSPVT
VKAEVVKLTGNRTAFITGAEGVFEKGSFERLTLPALPLHSAYGIYELRVTGRAQDELLFS
NSTRLSFDAKRMTVFTQTDKTVYKPKQEVKFRVVTLRSDFKPSKAPVNILIKLENENLVA
VWGMKSRQDFGVISKTFQLSSHPILGEWSIQVQVNEQTYYQLFEVAEYVLPKFEVALQTP
LYHCLKARSLNGIVTAKYTYGKPVKGDVTLTISPLSFWGIKKNITKKFKINGSANFSFNG
EEVRELMNFSNQLSEHMSPSSPGPVEILATVTESLTGISRSASSNVFFKQQKYTIDFFDY
ATVLKPSLNFTVTVKVAHPDGRQLTLEERMNNITIMMIQRNSTEYGRGWNSRNQEIEAFQ
VLNYSVPQNGILKIEFPILDNSTQLQLKAFFRKSMNSMAAYGVFKSPSKTYIQLKTRDEN
IKVGSPFELVVRGNKQFKEFNYMVISRGQLMAVGKQNSTTFSLIPENSWAPKARVMVYYI
EDDGEIINDVLKIHIQVDFENKVNLFWSKPHAEPSENVSLRVAVTQPHSLVGILAVDKSV
YLMNASNDITMENVVQELGLYNMGYYLGVFVNSFAVFQECGLWVLTDASLMKDDIDGVYD
SQSLDVEYMEENDGNFGDFYDFSSVENPHVRKHFPETWIWLDTNTGSGIYQEFEVTVPDS
ITSWIATAFVVSEDLGFGLTTTPAELEVFQPFFISPNLPNSVIRGEEFALEITIFNYLKV
DTEVKVIIEESDKFEILMASNEVNDTGHMQIVLVPNEDGVMVIFPVKPTHLGEIYITITA
ISPAASDAITQRLLVKAEGIEKFYSQSVLLDLNKRLKTTQKALTFSFPPNTVNGSERVQI
TVVGDILGSSISGLASLIQMPYGCGEQNMINFAPNIYVLESLKEKALSFMRQGYQRELLY
QREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADHYIDIDQNVLRRIYTWLKGRQKSNGEF
WEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYRKYQPHLDVKNSIKFLESEFLRGIPDNY
TLALTTYALSILGSPKAAEALDILTQRAELEGDMLFWVSSASGLSESWQPRSLDIEVAAY
ALHSHFLQNRISDGIAIMRWLSRQRNSLGGFVSTQDTIVALKALSEFAALMNTEGTHMQV
TITGPVAPSPVKFLIDTQNRFILQSAELAVAVPIEVNISADGYGFAVCQLNVFYNVKDSE
SSKNQKSIQSQKVFDLDVAVKDNEDDINHLNLNVCTRFLGPERSGMALMEVNLLSGFTVP
SNAIPLSETVKKVESNQGKLNLYLDSVNETQFCVDIPAVRNFKVSNAQDASVSIVDYYEP
RRRAVRSYNSKVKLSSCDLCSCPYESESGAPASLHHSPVVFVFCFMLLFSLQRWL
Download sequence
Identical sequences G1PQ94
ENSMLUP00000013234 ENSMLUP00000013234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]