SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021074 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021074
Domain Number 1 Region: 157-232
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.14e-26
Family GAS2 domain 0.00018
Further Details:      
 
Domain Number 2 Region: 3-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-18
Family Calponin-homology domain, CH-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021074   Gene: ENSMLUG00000012081   Transcript: ENSMLUT00000012087
Sequence length 632
Comment pep:putative scaffold:Myoluc2.0:GL430036:503561:507445:-1 gene:ENSMLUG00000012081 transcript:ENSMLUT00000012087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMGLATGTTLCQHANAVTEAARALAAARPARGVAFQAHSVAPGSFVARDNVATFIGWCRA
ELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEQELRAAP
SAPHAPAAEDEEGTPETAAAPGAPTRGPRMTPMDLRNLDELVREILGHCTCPDQFPMIKV
SEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPPPRTQT
FSPQRVSPTPSPRAGSPAPGGERRGSRPEATAMSSRSAKEGPETPLSPRARDQLPPHPRS
RRYSGDSDSSASSAQSGPLGARSDDSGTGPRRERPGRRLTTGTPASPRRPPAPRSQSRDQ
LDRGRPQEAPRGRRAQLSTPSPARRARSQRRSRLFLFVRRDQDGQHTWVPRVRAGGGSGR
SSPHTPRARSPAAPRPPRVSSPRPELGATPASVFRTPLQLDPQHEQQLFRRLEEEFLANS
RALGATAGGTPTGPAPDPARAPDAPGPDSAYCSSSSSSSSLCVLGGKCGQPGDSGRVANG
LPGCRGPALSSSSDEGSPCPGVGGQPDASGSHLAGPEPPRTWARGRMDTQPDGKPSRIPT
PRGPRRPSEPTVPGAWRALHSVSPRVEPDSWM
Download sequence
Identical sequences G1QBJ1
ENSMLUP00000021074 ENSMLUP00000021074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]