SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|313056|fgenesh1_pm.C_scaffold_1001836 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|313056|fgenesh1_pm.C_scaffold_1001836
Domain Number 1 Region: 719-944,1065-1112
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-72
Family Tandem AAA-ATPase domain 0.000000265
Further Details:      
 
Domain Number 2 Region: 1116-1222,1318-1401
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.56e-41
Family Tandem AAA-ATPase domain 0.0000367
Further Details:      
 
Domain Number 3 Region: 943-1064
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 1.26e-36
Family Pre-protein crosslinking domain of SecA 0.0000608
Further Details:      
 
Domain Number 4 Region: 519-709
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-25
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 1423-1534
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.53e-19
Family Helical scaffold and wing domains of SecA 0.0029
Further Details:      
 
Domain Number 6 Region: 4-59
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000153
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 7 Region: 166-442
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000379
Family Protein kinases, catalytic subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|313056|fgenesh1_pm.C_scaffold_1001836
Sequence length 1579
Sequence
MEAPECPVCLQSFDGESTVPRVLACGHTACEECLTNLPKKFPDTIRCPACTVLVKFPPQG
PSALPKNIDLLRLFPSISKIKLEPGRNFKKAVEFVIRSWSDDFYATWKDRILVHDAVSVE
IRESESSDFASASLLCGSLRDDLKVSLLRVASFEHDDCDSVLKYSYVLRMMSCLWGMREE
EIDELDAIISVKLRGVSKVFGLWGDLKNGVLYLVGEKLTGFLLEFDSLTEDDTSRVAIIG
MQICEALLNLHKEGLITGCLSVSCVKFDEFENAYVDLIELIETGRNVYRIIAEETSSFSK
PVGASEMGLILVRLLQKGIFLSSEVLFELLKEQNMLIKDSGSKSLVSYNSDVWPVCFLVL
KLRLGERFMEELIESVNCVDAKGCEEGIEDLLVLYTGITEKLSLESELQGKFKTMVEILR
QCCRLDPQARPVLTDLWKCIRELVVKPRFNSMTGLHKTISGKRKEFCLARSELCRLVEVE
SKELGEELPGMKTGEEAEEGKVDIDFARRLSEGKVKSKDMRGHQDSVTGLAVGGHQDKVM
ALIHIEGTESVCVSGDGGGGIFVWSTTFPLKEQPLRKWYEPKDWRYTGIHALAYSQYGHV
YTGSGDNTIKAWSLQDGSLVGTMSGHKSVVSTLVVVNGVLYSGSWDGTVRLWSLSDHSLL
TVLGEETPGIIWRDDTLMKSMQIQSGAILSIAVNGKWLFTGGWDKTINVQGNLGRLKRNI
QDFTSMNYWVVRDYYRLVESVNSLEPQMQSLSDEQLKAKTAEFRERLARGESLADMQAEA
FAVVREAAKRTIGMRHFDVQIIGGGVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVH
VVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQRGMKAEERKFNYSCDITYTNNSELGFDYL
RDNLTSNREQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEANENAARYPVAAKVAE
LLVKDSHYKVELKENSVELTEEGISLAEMALETSDLWDENDPWARFVMNALKAKEFYKRD
VQYIVRDGKALIINELTGRVEDKRRWSEGVHQAVEAKEGLEIQADSIVVAQITYQSLFKL
YPKLSGMTGTAKTEEKEFLKMFQIPVIEVPTNLSNIRIDLPIQAFATARGKWEHVRREVE
DMFGQGRPVLVGTTSVENSEYLSELLKEWGIPHNVLNARPKYAAREADFIAQAGRKYAIT
ISTNMAGRGTDIILGGNPKMLAREIIEDSILSYLTSEVLADNIDDNELSQKVLSKIKVGP
SSLASLARASLMAKYVGKSESKSWTRKKAKSVVTESLEKSQTMDPMKLQNLVNEQSEMYP
LGPAIALAYLSVLKDCEAHCLHEGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDP
GSTRFMISLQDEMFQKFNFDTEWAVRLISKITNDEDLPIEGDTIVKQLLALQINAEKYFF
GIRKSLVEFDEVLEVQRKHVYDLRQLLLTGENESCSQHIFQYMQAVVDEIVVGNANPQKH
PRYWSLAKLLKEFMAISGNLLDEETMLQSLENLHERSSIDMEDLYLPHLPKPPNAFRGIR
RKNSSLRRWLDICSDNLTG
Download sequence
Identical sequences D7KK34
59689.fgenesh1_pm.C_scaffold_1001836 XP_002893179.1.15461 jgi|Araly1|313056|fgenesh1_pm.C_scaffold_1001836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]