SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|486909|fgenesh2_kg.6__43__AT4G00020.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|486909|fgenesh2_kg.6__43__AT4G00020.1
Domain Number 1 Region: 454-622
Classification Level Classification E-value
Superfamily BRCA2 helical domain 4.58e-59
Family BRCA2 helical domain 0.0004
Further Details:      
 
Domain Number 2 Region: 623-751
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.97e-37
Family Single strand DNA-binding domain, SSB 0.00023
Further Details:      
 
Domain Number 3 Region: 753-782,901-986
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-25
Family Single strand DNA-binding domain, SSB 0.0098
Further Details:      
 
Domain Number 4 Region: 783-900
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.35e-16
Family BRCA2 tower domain 0.0033
Further Details:      
 
Domain Number 5 Region: 991-1143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000326
Family Single strand DNA-binding domain, SSB 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|486909|fgenesh2_kg.6__43__AT4G00020.1
Sequence length 1151
Sequence
MSTWQLFSDSSGDGFRWEVAGRILQSDSDSTPTKALESTAPLPSMADLLLQGCSKLIERE
EALPGEIPMFRTGLGKSVPLKESSMAKAKSLLADSGTFLDLQNTNCSNPQMRQVDSAETL
PMFRTALGKSVPLKESSIAKALSILASDKIIDSDYVLPRESGFGVPNTLFQTASNKKVNV
SSAGLARAKALLGLEEDDLNGFNHVNQSSSSLQQHGLSVLKTHEEFDATVVKHHSGTPGQ
YEDYVSGKRPEILNPSLKVPPTKFQTAGGKSLSVSAEALKRARNLLGDPELGSFFDDVAG
GDQFVTPQKDERLGDIAINNGSANTGYIAHEEKSSNKHTSNSFVSPLRSSSKQFRSVNLE
NLASGGNLIKKFDAAVDDTDCALNATHGLSNNKPIASNMAVTNSKENGFIPRARQFGRPA
DQPLVDITNCSDTAYANIKQDSTQKKRLGKTVSVSPFKRPRISSFKTPLKKNAQQASSGL
SVVSCDTLTSKKVLSTRYPEKSPRVYIKDFFGMHPTATTKMDYVPDHVRRIKSSNADKYV
FCDESSSNKVGAETFLLMLAESGASLQHASRKWVTNHYRWIVWKLACYDIYYPAKCRGNF
LTITNVLEELKYRYEREVNHGHCSAIKRILSGDAPASSMMVLCISAINPKTDNDSQEAHC
SDICSNVKVELTDGWYSMNAALDVVLTKQLNAGKLFVGQKLRILGAGLSGWATPTSPLEA
VISSTICLLLNINGTYRAHWADQLGFCKEIGVPLAFNCIKCNGGPVPKTLAGITRIYPIL
YKERLGEKKSIVRSERMESRIIQLHNQRRSALVEGIMCEYQRGINGVHSQNDTDSEEGAK
VFKLLETAAEPELLMAEMSPEQLTSFTIYKAKFEAAKQMQMEKSVAKALEDAGLGERNVT
RFMRIRLVGLTSLSYEGEHNPKEGIVTIWDPTERQRTELTEGKVYIMKGLVPMNSDSETL
YLHARGSSSKWQPLSQKDSANFQPFFNPRKPISLSNLGEIPVSSEFDIAAYVVYVGNAYT
DVQQKKQWVFVTDGSTQHSGENSNSLLAISFSTPSMEDSSISHISHNLVGSVVGFCNLIK
RAKDAKNKMWVGEATENSVYFINAEAAYSSHLKTSSAHIQAWAKLSSSNTVIHELRQTVL
SIIGACKSPSC
Download sequence
Identical sequences D7M6H1
XP_002870909.1.15461 jgi|Araly1|486909|fgenesh2_kg.6__43__AT4G00020.1 59689.fgenesh2_kg.6__43__AT4G00020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]