SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|887819|scaffold_100613.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Araly1|887819|scaffold_100613.1
Domain Number - Region: 362-394
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000981
Family Rho termination factor, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|887819|scaffold_100613.1
Sequence length 401
Sequence
MAMSGTFHLTSDYVPGYTLSDSRSFSTSAVSRRTLSILPCSSCLDHKNGRLKSVSNKNAF
LCRASSGGYRRNPDFSRLNKHGFRGNNRQSEGRDDLDIENSDMLSSRNGPLFSLSSSPKF
QAISSPGPREKEIVELFRKVQAQLRARAASKKEEKKIEEASKGQGKESETVDSLLKLLRK
HSGEQSKKQVSKFSSQGEVQEDTVDKQNRNGNLVNSGNKDNNASSFTRPTSSFRRKSPVP
RSKSPPAYSSEATFDQSSSYSVTWTQKKDTVELQDEPEHEPEIEHEPEYEHEPENESEPG
PLTTMLKKESELKPDSSSLFQEEEDDEVTLDDDGILDVFSDDDESHDDADEDSDEAEEEA
VKDLSKLKLMELRGLAKSRGLKGFSKMKKAELVELLSSNSS
Download sequence
Identical sequences D7KG06
XP_002892326.1.15461 59689.scaffold_100613.1 jgi|Araly1|887819|scaffold_100613.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]