SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|317478|fgenesh1_pm.C_scaffold_3000494 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|317478|fgenesh1_pm.C_scaffold_3000494
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-22
Family B3 DNA binding domain 0.00018
Further Details:      
 
Domain Number 2 Region: 250-328
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000141
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|317478|fgenesh1_pm.C_scaffold_3000494
Sequence length 341
Sequence
MWATKSRRCAVHTSSMASSDVLPRFFTVFLSQYSSESMVIPRSYYEHLPRRLPKTAILVG
TGGRFWKVAMTSRREQVYFEQGWGNFVADNELKDGEFLTFVFDGHKSYEVSIYGRGDCKE
TRAVIQVEEISDDDTEDYSVSLHSLNNVSLHSLDNDSLQADVEIESDSLMADVEIESDSL
QVDAEIESDSDYSPENPDTASTSVESVEVVNPTTSMTSRQRSYKKKTIENPELYLDDPNN
ICFETCLKLRKFELLVDAQFVKDYSLKFGDQVDYIDGYGKLTATMTKWADQRVCIKKWQK
ICDRNSLTENDSILCEVLRNEDKVVYAIKIHIFRDAAAAST
Download sequence
Identical sequences D7L4S8
XP_002882451.1.15461 59689.fgenesh1_pm.C_scaffold_3000494 jgi|Araly1|317478|fgenesh1_pm.C_scaffold_3000494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]