SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|318465|fgenesh1_pm.C_scaffold_3001481 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|318465|fgenesh1_pm.C_scaffold_3001481
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-19
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 198-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-16
Family B3 DNA binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|318465|fgenesh1_pm.C_scaffold_3001481
Sequence length 302
Sequence
MGRRRNIGFDKIIEERKMLSFFKIFQSSDLSSECMRAFSYSFISRLSRKDFSYKMVIRAQ
WGKTWHLEISKNPRYYYIERRGWDQFVSDNALGENEFITFTHRGNMVFHVNIYEQNGVEM
LTPRKFQTMDSSSGIKKEGESSFKDVKKEEETDESAGRAEFVVRKRKTEESKSSKKKMER
KKKKSKSKSKSKEVLNGVPEFKITIRKSYLKFLAIPKHFVDDHIPNKSKFFTVRHPNGIG
SWKVLCLVREIRTIFSGGYSKLAREYPLMVGDKCTFKLIKPFEFVLLTSKKTRDEIDHYM
ID
Download sequence
Identical sequences D7L6A0
XP_002883038.1.15461 jgi|Araly1|318465|fgenesh1_pm.C_scaffold_3001481 59689.fgenesh1_pm.C_scaffold_3001481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]