SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|319704|fgenesh1_pm.C_scaffold_3002720 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|319704|fgenesh1_pm.C_scaffold_3002720
Domain Number 1 Region: 124-234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-29
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 514-592
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000275
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|319704|fgenesh1_pm.C_scaffold_3002720
Sequence length 597
Sequence
MESGNVVNAQPELSGITIDVSKRYMYEQLWKLCAGPLCDIPKIGEKVYYFPQGHIELIEA
YTREELNKIQPIFDLPSKLQCRVIAIQLKVEKNSDETYAEITLMPDTQVVIPTQNDNHYR
PLVNSFTKVLTASDTSVHGGFSVPRKLAIECLPPLDMSQPLPAQELLTIDLHGNQWRFKH
SYRGTPRRHLLTSGWNAFTTSKKLVAGDVIVFLRGETGELRVGIRRAGHQQKNIHSSLIS
IDSMRHGVIASAVHAFNNQCMFIVVYKPRSSQFIVSYNKFVDAVNNKFNVGSRFTMRFEG
EDFSERRYSGTIIGVNNFSSHWMESEWRSLEVKWDEFASFPRPDKVSPWDIEHLTPSLNV
LRPSLLKNKRSREVNEIGSTSSHLLHPILTQGQEIGEPSMTSPMNVFLSYCDEIEDDETP
SRMLMSYHVPTMPKLNYNNDQMVTPIEENITTNANASFRLFGVSLATSSVIKDPIEPMES
YPKSEISKLCQEKKLGLGQTITSPREIQSKQFSSTRSCTKVQMQGVPVGRALDLNVLNGY
DHLIIELEKLFDLNGQLQTRNQWKIAFKDNEGNEKLVGDNPWPEFCSMVKKIFIYPK
Download sequence
Identical sequences D7L9F7
XP_002884067.1.15461 jgi|Araly1|319704|fgenesh1_pm.C_scaffold_3002720 59689.fgenesh1_pm.C_scaffold_3002720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]