SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|320274|fgenesh1_pm.C_scaffold_4000331 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|320274|fgenesh1_pm.C_scaffold_4000331
Domain Number 1 Region: 183-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-22
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 31-123
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-21
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 3 Region: 572-659
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-20
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 4 Region: 490-551
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000412
Family B3 DNA binding domain 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Araly1|320274|fgenesh1_pm.C_scaffold_4000331
Domain Number - Region: 345-376
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0785
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|320274|fgenesh1_pm.C_scaffold_4000331
Sequence length 680
Sequence
MMIQVSDHHDNNIEFQRQKNSSETEADYSCFVTASSQQTDALRLPMQFTRENGINKPGKI
YLLGKDGSKWLANLLSENNRGRMTLGDGWKSFVKANGLKTGDTYTFKLFWDDTIPVLSLC
SEEYNTDTRVGEECSKESLPTEPSSQEKVVKDDNNKHESNKDESSLWKREDNHLRCIDST
SPSENRSLTLTITPDSLEHGRLRLPLQFMTENNMNKPGEITLLGKDGAKWMASLLLERRG
RMSLGKGWKDFAKANGVKTGDSITLESIWEDTTPVLKLISIESSSGQFSKESLSVEPSSG
NMTEKAEKNREASRKYPPRSRESSSAIENQFMALTPSCDIISQVAHDLRIGEVIIFRHEG
DNMLQVSDLGPNCCGILDVPAPSSNNDHDNIEHPSKKKVKKNNPETEADYLSDHSCSVAH
VTTSSLHANALSLAVKESITIEPSIDDNNKDESSKEENDIEEKSNNKNNIEESSSFEREK
NHRICIDSISSSHNRFLTLTITPDSLKHGRLRLPLQFMTENSMNKPGEITVLGKDGAKWL
VSLLLERRGRMSLDASSGHKTREAEKNRDSSSEIENRFLTLTLAPEDVKDGNLHLPIQFM
RINGINKPGKITLLGRGGLKWFAYLLSRDGTVVLGNGWKGFCEANGVMLGESFILEFISI
EDTNHVFKFYSSYGDQIDKC
Download sequence
Identical sequences D7LIB5
jgi|Araly1|320274|fgenesh1_pm.C_scaffold_4000331 59689.fgenesh1_pm.C_scaffold_4000331 XP_002880606.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]