SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|322150|fgenesh1_pm.C_scaffold_4002207 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|322150|fgenesh1_pm.C_scaffold_4002207
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000143
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 119-194
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000314
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|322150|fgenesh1_pm.C_scaffold_4002207
Sequence length 213
Sequence
MTTNGESDTVFLRDGWKKIVKDENLTEPTFLVFEFDDSCVIHFCVYEHGSMCKRMRSPMG
KEVIEVESDEENEEEVVEDEDSSTKGFYESPRRKNRGDTSRRCWYLNTFDEYLDNKLNPS
FPVDMTQKRTRIPAVLINDYNLTFPNLVIVRDKIGKLKRRISIWKNGSVCLNGIDSITRR
NHVKRGDKMLLELKTVDGYHGLVREIKVHIIKC
Download sequence
Identical sequences D7LBT4
59689.fgenesh1_pm.C_scaffold_4002207 jgi|Araly1|322150|fgenesh1_pm.C_scaffold_4002207 XP_002881987.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]