SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|323305|fgenesh1_pm.C_scaffold_5000849 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|323305|fgenesh1_pm.C_scaffold_5000849
Domain Number 1 Region: 14-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000353
Family B3 DNA binding domain 0.00079
Further Details:      
 
Domain Number 2 Region: 180-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000011
Family B3 DNA binding domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|323305|fgenesh1_pm.C_scaffold_5000849
Sequence length 275
Sequence
MEENSSQNELLDTVQKFFRVYIPNQTADDMNLPLVLDKISGKPLPRKVTVKSVSSGNIWR
MEMKANGDTVFLRDGWKRIVKDENVTETIFLELEFDGSGVFHFCVYEYGSMCKRMRSPME
KEVIKVDSTEEEIEEDVLVDDEESTKGLEESPRRGGTSRRRENLKTDSHKFYEHLGNKLN
PSFPVDMTQSRTRIPSLLIKDYNLTFPNMVIVRDKIGILKRRIAVWKNKSVYLNGISSII
RRNHVKPGDEMVFELKMVNGYHGLVHEIKVHIIKA
Download sequence
Identical sequences D7LN48
59689.fgenesh1_pm.C_scaffold_5000849 jgi|Araly1|323305|fgenesh1_pm.C_scaffold_5000849 XP_002875801.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]