SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|324535|fgenesh1_pm.C_scaffold_5002079 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|324535|fgenesh1_pm.C_scaffold_5002079
Domain Number 1 Region: 2148-2429
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-115
Family BEACH domain 0.0000000206
Further Details:      
 
Domain Number 2 Region: 2544-2612,2646-2760,2794-2841
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.85e-32
Family WD40-repeat 0.0099
Further Details:      
 
Domain Number 3 Region: 2027-2136
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-23
Family PreBEACH PH-like domain 0.0023
Further Details:      
 
Domain Number 4 Region: 379-524
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000871
Family Clostridium neurotoxins, the second last domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|324535|fgenesh1_pm.C_scaffold_5002079
Sequence length 2860
Sequence
MEEDDENKFPKASDGHLHVAEKPNVVENRIDAFDLGNSNLQGISSVDAVLKDDTFEQVSL
GDQDSSATSLDSFYHQESGYPVVHSPQRPKPKATMPNVSPELLHLVDSAIMGKPESLDKL
KNIVSGVESFGSGEDSESIAFLVIDSLLATMGGVESFEEDEDSNPPSVMLNSRAAIVAGE
LIPCLPCSGDSVSFMSPRTRMVRGLLAILRSCTRNRAMCSMAGLLCVLLRSVEEIVSKDA
TMMWNGTVLFHCIQHLAGHSLSVDDLYRWLHVIKKSLPTVWSSPLIDALEKAMNGKESRG
PACSFEFVGESSGLLGPGESRWPFTNGYAFATWIYIESFADTLDASTAAAAIAAASAAKS
GKTSNAAPANVHTGEGTAHMPRLFSFLTPDNQGIEAYFYAQFLVVESGSGKGSKTSLHFT
HAFKPQCWYFIGLEHTCNQGLLGNSDSELRLYIDGSLYETRPFEYPRISKPLSFCCIGSN
SPSTTAGLQRRRRPCALFAEMGPVYIFKEPIGPERMTRLATRGGDVLPCFGNGAGLPWLA
TNDHVRNVAEESSLSDAELGGYIHLLYHPCLLSGRFCPDASLSGAAGTQRRPAEVIGKVH
VATRMKSVESFWALAYGGPMSLLPLTVSSVHKDSVEPCSRNVPSSLTTYSLAAPIFRMIS
VAIQHPGNNEELSRTRGPEILATILGYLLHSLASLDLQHDRVGDEELVAAIVSLCQSQKI
NHALKVQLFRTLLLDLKIWSVCNYRLQKKLLSSLQDMVFTEATAMRNADAIQVLLDGCRR
YFWTIQEKDSVNTFSLHGDARQVGEVNALVDELLVIIELLMGAASSSFAADDLHRLLGFI
IDSPQPNQVSRVLHLMFRLVVQPNAAKAQTFAEAFITSGGIETLLVLLQREAKTGEDDVA
DSVAKGETNVPTYHSEQSYHNGPGLLKQLDSVPQDNESDPHTHDDNVGSLKETESVQQEK
AHGSATVICDSDSVTISNSMKAGRISSVSETPFNNNARNNVDDRDRVMVGIIRLIGALTS
KGHLKFSVGAKSDVMSNLMGSDFHENGGTMFDDKVALLLFALLKAFQAAPNRLMTDNVYT
TLLGASVNASSTEDGLNFCDLGHRFEHPQLLLILLRSLPFASKALQNRALQDILFLACSH
PENRSSLTKMEEWPEWILEILISNYEKDAGKQSSSPGFAEVEDLIHNFLIIMLEHSMRQK
DGWKDIEATIHCAEWLSIVGGSSTGEKRIRREESLPIFKRRLLGGLLDFAASELQAQTQV
IAAASAGFAAESLTPKDAKAGVENAALLSVFLVENTVVILMLVEDHLRLQSKQNCAASAV
DVSPSPLSLVYPPNYRSHTLPTVGESSEVSSSRASVSSDSGGVHLDILASMADASGQIST
AVMERLAAAAAAEPYESVSCAFVSYGSCTMDLADAWKYRSRLWYGVGLPSKTSCFGGGGS
GWDSWKHALQKDAQGNWIELPLVKKSVSMLQALLLDESGLGGGLGICGGSGTGMGGMSGL
YQLLDSDQPFLCMLRMVLLSLREEDHGEDSLLMKNLSSEDGITGGIQCPLGNSASLDISS
QLSMRQSPSALLWSVLSPILNMPISDSKRQRVLVTTCVLYSEVWNAVSKDKRPLRKQYLE
AILPPFVAILRRWRPLLAGIHELATGDGLNPLVVDTRALAADALPIEAALSMISPEWAAA
FASPPSAMALAMIAAGAAGWEAPAPPAAPAPPPLRRDTSLLERKSTKLQTFSSFQKPLEA
PNVDTPGRPRDKAAAKAAALAAARDLEWNAKIGSGRGLSAVAMATSAARRNISDMERLQR
WNISEAMGVAWIECLQPVDTKSVYGKDFNALSYKFIALLVASFAFSRNMQRSEIDRRLQN
DKIVRNRLCMGIRGWRKLVHHLIEMRCFFGPFGDHLCSPKHVFWKLDSMESSSRMRQCLR
RNYSGTDHLETTRNYDDQTDLKNKQDAPVLAVEAISKEIMYEDNEHGDANDLEIEGNVGH
KGENEERRSGSLEDAITLSTGINDHRPLSEQNMVQNSPEVDLSELKERIILEISSTMVRP
LGVVKGTFQITTRRINFIVDIREDQHLDGKSDGLKLRDKERDRSWLMSSLHQIYSRRYLL
RKSALELFMVDRSNYFFDFGNTEGRRNACRAIVQARPPHLKNIYLATQKPEQVSRRTQLM
ESWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWILCDYVSEILDLSNPSNYRDLSKP
IGALNPERLKKFQEQYSSFEDPVIPKYHYGSHYSSAGAVLHYLARVEPFTTLLIQLQGRK
FDRADQIFSDIAATWKGVLQDMNNVKELVPELFYLPEVLSNENLVENLDSVKLPPWAKSP
IDFVHKQRMALESEHVSAHLHEWIDLIFGYKQRGKEATLANNVFFYTTYEGTVDIDKITD
SVQQQATQDQIVNFGQTPSQLWTVPHIKRMPLKDVLHMQTIFRNPKAIKPYPVPAPEHCN
LPAAAIKASSDTVVIVDMNVPAAHIAQHKWQPNTPDGQNAPFIFHHGKPSSTGGTLIRMF
KSDWEYPQAQAFASLGIRSSSVTAITNDGEIITGGHVDNSIKIVSSDGAKTLETAFGHSA
PVTCLALSPDNNFLVTGSRDTTVLLWRFHKGFTSQTSESEQTTSSVTSSSASSNNLANKA
KKHRIEGPIQVLRGHQREISCCCVSSDQGIVVSCSESSDVLLHSTRKGRLIRRLVGVEAH
ALCISSDGVIVVWSRSESCISTFTINGVLISKARLPSSCTISCMELSMDGQNVVIGVNSF
FDIDGSRSFNILTGEEDSSNRSKEVERLNIPSPSICFLNLYTLQVFHVLKLGEGQGITTM
ALNTDNTNLLVSTEDKQLIIFTNPALSSKLVDQTLKPGSE
Download sequence
Identical sequences D7LRV7
59689.fgenesh1_pm.C_scaffold_5002079 XP_002878354.1.15461 jgi|Araly1|324535|fgenesh1_pm.C_scaffold_5002079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]