SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|329065|fgenesh1_pm.C_scaffold_7001292 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|329065|fgenesh1_pm.C_scaffold_7001292
Domain Number 1 Region: 265-369
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000668
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 60-184
Classification Level Classification E-value
Superfamily POZ domain 0.000000000604
Family BTB/POZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|329065|fgenesh1_pm.C_scaffold_7001292
Sequence length 596
Sequence
MATTTARFSDSSYEFSNTSGNSFFAAESSIDYPSEFLTPPEVSALQLLSNCLESVFDSPE
NFYSDAKLVLAGGREVSFHRCILSARIPVFKSALATVKEQKSTTVKLEMKKIATDYEVGF
DSVAAVLAFVYSGRVRPPPKGASDCVDDDCCHVACRPKVDFMVEVLYLAFVFQIPELVTM
YERQFLKIVDKVVVEDILVIFKLDTLCGQTYKKLLDRCIEIIVKSDIELVSLEKSLPQHF
VKQITGIRKALGLEPPELQIHVKNLYKALDSDDVELVKMLLLEGHTNLDMAYALHFAIAH
CDVKTAYDLLELELADVNHRNPRGYTVLHVAAMRKEPKLIISLLMKGANVLDTLLDGRTA
LVIAKRLTKTDDYKTSMEDGTHSLKGGLCIEVLEHEQKLEYVLPREASLSLPVTPEELRM
MLLYYENRVALARLLFPVESEIVQDIAKLDETCEFTASSLEPDHRIGEKRTSLDLNMAPF
QIHEKHLSRLRAVCKTVELGKRYFRRCSLDHFMDTEDLNHLASVEEDTPEKRLQKKQRYV
ELQETLMKTFSEDKEEFGKPSTAKPTSAMRSNRKLSHRRLRVDKRDFLKRPCGNGD
Download sequence
Identical sequences D7MFC8
jgi|Araly1|329065|fgenesh1_pm.C_scaffold_7001292 59689.fgenesh1_pm.C_scaffold_7001292 XP_002869627.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]