SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|330218|fgenesh1_pm.C_scaffold_7002445 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|330218|fgenesh1_pm.C_scaffold_7002445
Domain Number 1 Region: 12-562
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.79e-95
Family Acetyl-CoA synthetase-like 0.00000865
Further Details:      
 
Domain Number 2 Region: 764-1118
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.16e-40
Family Quinoprotein alcohol dehydrogenase-like 0.009
Further Details:      
 
Domain Number 3 Region: 579-637
Classification Level Classification E-value
Superfamily ACP-like 0.0000176
Family Acyl-carrier protein (ACP) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|330218|fgenesh1_pm.C_scaffold_7002445
Sequence length 1120
Sequence
MSERNRGKSENCCISHKFVAASKNPHQIAVIQASGLTARRIRSESAEPSVYDGDKCFTFA
ELSSSIDSLTSRLRRILSDDDSQEAGSDVVYMPKVVALYMPPSVEYIISVFSVLRCGEAF
LPLDPTWPRERVLSLISSSNASLVIALERSHWLVETKVCPVLLFSMDEKLSEETGCSSFV
WPCKKQRQRKFCYLMYTSGSTGKPKGVCGTEQGLLNRFVWMQELYPVVGEQRSAFKTSVG
FIDHLQEFLGPILNSTPLVIPPFTLLKENMTSIIDFLEVYSISRLLAVPSMIRAILPTLQ
HRGHNKLQSSLKLVVLSGEPFPVSLWDSLHSLLPETCFLNLYGSTEVSGDCTYFDCSGLP
RILKTEEIGSVPIGKPISNCKVLLFGDEDKPYEGEICVGGLCISQGYMHSSIESQGYVKL
HNNKSLCNHLTNDCGSELYYRTGDYGRQLSSGDLIFIGRRDRTVKLNGKRMALEEIETTL
ELNPDVAEAVVLLSRDEKELASLKAFLVLNKESNSGDGIIFSIRNWMSEKLPTVMIPNHF
LLVESLPLTASGKVNYEALARLKCPKTLAQDMMHSNGTNSLLQTIKKAVCDALVVKEVLD
DDDFFAIGGDSLAAAHLSHSLGIDMRLIYQFRSPSRLLICLSEKEGKLREDTQHNTTQKL
DHKTESQNGNGLVSRTVPRHSGVTSSPTPSGMQCEKNNSPKRLKIDSKIFSPKMKEKKSW
DSGFSQTQCAFSRCNKVYSPNSCSNEEANRENWSVEIPRNQMVSMQEIWKVHMESCVDAS
PLVVLKDSKTYLFIGSHSRKFSCIDAKSGSIYWETTLEGRVEGSAMVVGDFSQVVVGCYK
GKLYFLDFSTGSLCWTFQACGEIKCQPVVDASSQLIWCGSHDHTLYALDYRSQRCVYKLQ
CGGSIFASPLIDEGHSLLYVASTSGRVIAVSIEDLPFHTLWLLDLEAPIFGSLCITPTSR
SVDGQVIAMSTSGTIIWRYRTGGPIFAGPCMSHVLPSQVLVCCRNGSVYSLEPESGCLVW
EYNIGDPITASAYIDENLHFESHQLLASDRLVTVCSSSGRVHVLRVRTNHSRDSLDLKVG
EIARLELQADIFSSPVMIGGRIFVGCRDDYVHCLSLESCR
Download sequence
Identical sequences D7MHX6
59689.fgenesh1_pm.C_scaffold_7002445 XP_002870455.1.15461 jgi|Araly1|330218|fgenesh1_pm.C_scaffold_7002445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]