SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|332063|fgenesh1_pm.C_scaffold_8001406 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|332063|fgenesh1_pm.C_scaffold_8001406
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-20
Family B3 DNA binding domain 0.00037
Further Details:      
 
Domain Number 2 Region: 201-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000051
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|332063|fgenesh1_pm.C_scaffold_8001406
Sequence length 297
Sequence
MELENGFPPYPDFLKIFNSHEHAQRLVIPRGYNKYYPNPLPQTAVLKKPEGSFWNVKWTI
SQEETIRFQEGWEKFVKDNGLIDRDFLLFTYDGCRSFWVRIHRNGLPLEPTAPIKIQEIS
DDEDDTIGHGDHHMEEGDSHENMIVSLSLGSSDEADDDDDYDTTICEVNKASESSKKGRL
ARKHRADSIAASIDPETYLDDPKNPFFISTSSCSRRVLVIARQVIKDYDLNFDGTIKLID
GFGELTRKVGKWKDRVVVYKWDEMFTRNKANQGDAIICEVIREEDVVRSIKVHFVKN
Download sequence
Identical sequences D7MNV0
59689.fgenesh1_pm.C_scaffold_8001406 XP_002866225.1.15461 jgi|Araly1|332063|fgenesh1_pm.C_scaffold_8001406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]