SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|336503|fgenesh1_pg.C_scaffold_1003068 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|336503|fgenesh1_pg.C_scaffold_1003068
Domain Number 1 Region: 81-206
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-32
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 480-559
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000196
Family PB1 domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|336503|fgenesh1_pg.C_scaffold_1003068
Sequence length 578
Sequence
MTLGLRGSNKIFYALDGTHHTISHTLPCKAKQPPPLQRRVIAIQLKVERNSDETYAEITL
MPNTTQVVIPTQNENQFRPLVNSFTKVLTASDTSAHGGFSVPRKLAIECLPPLDMSQPLP
AQELLTIDLHGNQWRFKHSYRGTPRRHLLTTGWNAFITSKKLVAGDVIVFLRGETGELRV
SIRRARYQQGNIPSSLISIESMRHGVIASAKHAFDNQCMFIVVYKPRFIFCVCISIRSSQ
FIVNYDKFLDAVNNKFNVGSRFTMRFEEENFSERRYFGTIIGVSDFSPHWKCSEWRSLKV
QWDEFASFPRPDKVSPWEIKHSTPSSNVLPSSMLKNKRSREFNEIGSSSSHLLPPILTQG
QEIGQPSMTSPMNVPLSYRDAIEDDSTPSRLLMSYSVQTMPRLNYNNDQIVTPIEGNITN
NGGASCRVFGVSLATPPVIKDPIEQIDSDPNLEISKLSQEKIFGLGQMRSTREIQSKQLS
STRTCTKVQMHGVTLGRALDLSVLNGYDQLILELEKLFDLKGQLQNRNQWEIVFTDNEED
EMLVGDDPWPEFCNMVKKIIIYSKEEVKNFKSGNSRSN
Download sequence
Identical sequences D7KK63
XP_002891101.1.15461 jgi|Araly1|336503|fgenesh1_pg.C_scaffold_1003068 59689.fgenesh1_pg.C_scaffold_1003068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]