SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|339541|fgenesh1_pg.C_scaffold_2001640 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|339541|fgenesh1_pg.C_scaffold_2001640
Domain Number 1 Region: 247-322
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.66e-17
Family Dual specificity phosphatase-like 0.0044
Further Details:      
 
Domain Number 2 Region: 16-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-16
Family B3 DNA binding domain 0.00036
Further Details:      
 
Domain Number 3 Region: 187-243
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000712
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|339541|fgenesh1_pg.C_scaffold_2001640
Sequence length 338
Sequence
MGPRLQTESLVYVFAADQNSFVCVEQLIPISYYEHLPRRLPKTAILMGTGGKIWKVAMKS
KHEKVYFERGWANFVADNALKDAEFLSFVFDGYRRYAVSIYGYGEKEINDDETKSDTDYS
PDSLDTTTILVESVQVFNKSATSRKRANTIENPEAYLDDPNSISFETALKDRPYELPQTQ
IVQEREEDGVVPKKLYVRGIPYQSTEDEIRSYFRSCGVITKFDCKMRPEDGAFSAFITFE
TLELVWCLCFSFIDQAIQSGGGVLVHCFMGMSRSLLILVSLGTVVRVVAYLMKKHGMGFS
KAVELIRSRRHQAYPNSGFICSSNNLKNPSKTNLFQDH
Download sequence
Identical sequences D7KRA1
XP_002888927.1.15461 59689.fgenesh1_pg.C_scaffold_2001640 jgi|Araly1|339541|fgenesh1_pg.C_scaffold_2001640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]